UBE2D2 antibody

Catalog No. ABIN630401

Product Details anti-UBE2D2 Antibody

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2D2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: UBE2 D2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2D2 Blocking Peptide, catalog no. 33R-8733, is also available for use as a blocking control in assays to test for specificity of this UBE2D2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2D2

Target: UBE2D2 (Ubiquitin-Conjugating Enzyme E2D 2 (UBE2D2))

Alternative Name: UBE2D2 (UBE2D2 Products)

Synonyms: E2(17)KB2 antibody, PUBC1 antibody, UBC4 antibody, UBC4/5 antibody, UBCH5B antibody, 1500034D03Rik antibody, Ubc2e antibody, Ube2d2 antibody, ubc4 antibody, ube2d2 antibody, zgc:55886 antibody, E217kB antibody, ubiquitin conjugating enzyme E2 D2 antibody, ubiquitin-conjugating enzyme E2D 2A antibody, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) antibody, ubiquitin-conjugating enzyme E2D 2 antibody, ubiquitin conjugating enzyme E2 D3 antibody, UBE2D2 antibody, Ube2d2a antibody, ube2d2 antibody, Ube2d2 antibody, UBE2D3 antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades