FAM55D antibody (C-Term)

Catalog No. ABIN630400

Product Details anti-FAM55D Antibody

Target: FAM55D (Family with Sequence Similarity 55, Member D (FAM55D))

Binding Specificity: C-Term

Reactivity: Human, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM55D antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FAM55 D antibody was raised against the C terminal of FAM55

Purification: Purified

Immunogen: FAM55 D antibody was raised using the C terminal of FAM55 corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM55D Blocking Peptide, catalog no. 33R-9404, is also available for use as a blocking control in assays to test for specificity of this FAM55D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM55D

Target: FAM55D (Family with Sequence Similarity 55, Member D (FAM55D))

Alternative Name: FAM55D (FAM55D Products)

Synonyms: Fam55d antibody, Nxpe4 antibody, C11orf33 antibody, FAM55D antibody, C130036J11 antibody, D930028F11Rik antibody, neurexophilin and PC-esterase domain family member 4 antibody, neurexophilin and PC-esterase domain family, member 4 antibody, Nxpe4 antibody, NXPE4 antibody

Background: The function of FAM55 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 60 kDa (MW of target protein)