UST antibody (C-Term)
-
- Target See all UST Antibodies
- UST (Uronyl-2-Sulfotransferase (UST))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UST antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- UST antibody was raised against the C terminal of UST
- Purification
- Purified
- Immunogen
- UST antibody was raised using the C terminal of UST corresponding to a region with amino acids YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UST Blocking Peptide, catalog no. 33R-10095, is also available for use as a blocking control in assays to test for specificity of this UST antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UST antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UST (Uronyl-2-Sulfotransferase (UST))
- Alternative Name
- UST (UST Products)
- Background
- UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-