MOSPD3 antibody (C-Term)

Catalog No. ABIN630396

Product Details anti-MOSPD3 Antibody

Target: MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MOSPD3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MOSPD3 antibody was raised against the C terminal of MOSPD3

Purification: Purified

Immunogen: MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MOSPD3 Blocking Peptide, catalog no. 33R-2967, is also available for use as a blocking control in assays to test for specificity of this MOSPD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOSPD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MOSPD3

Target: MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))

Alternative Name: MOSPD3 (MOSPD3 Products)

Synonyms: CDS3 antibody, NET30 antibody, 1190005J19Rik antibody, 5133401H10Rik antibody, Gtig2 antibody, R124 antibody, cds3 antibody, MGC89012 antibody, MOSPD3 antibody, motile sperm domain containing 3 antibody, motile sperm domain containing 3 L homeolog antibody, MOSPD3 antibody, Mospd3 antibody, mospd3 antibody, mospd3.L antibody

Background: MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality.

Molecular Weight: 24 kDa (MW of target protein)