MOSPD3 antibody (C-Term)
-
- Target See all MOSPD3 Antibodies
- MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MOSPD3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- MOSPD3 antibody was raised against the C terminal of MOSPD3
- Purification
- Purified
- Immunogen
- MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM
- Top Product
- Discover our top product MOSPD3 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MOSPD3 Blocking Peptide, catalog no. 33R-2967, is also available for use as a blocking control in assays to test for specificity of this MOSPD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOSPD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MOSPD3 (Motile Sperm Domain Containing 3 (MOSPD3))
- Alternative Name
- MOSPD3 (MOSPD3 Products)
- Background
- MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality.
- Molecular Weight
- 24 kDa (MW of target protein)
-