SLC13A3 antibody
-
- Target See all SLC13A3 Antibodies
- SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC13A3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SLC13 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF
- Top Product
- Discover our top product SLC13A3 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC13A3 Blocking Peptide, catalog no. 33R-3423, is also available for use as a blocking control in assays to test for specificity of this SLC13A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC13A3 (Solute Carrier Family 13 Member 3 (SLC13A3))
- Alternative Name
- SLC13A3 (SLC13A3 Products)
- Background
- Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-