TOR2A antibody (N-Term)
-
- Target See all TOR2A Antibodies
- TOR2A (Torsin Family 2, Member A (TOR2A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TOR2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TOR2 A antibody was raised against the N terminal of TOR2
- Purification
- Purified
- Immunogen
- TOR2 A antibody was raised using the N terminal of TOR2 corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS
- Top Product
- Discover our top product TOR2A Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TOR2A Blocking Peptide, catalog no. 33R-3388, is also available for use as a blocking control in assays to test for specificity of this TOR2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOR2A (Torsin Family 2, Member A (TOR2A))
- Alternative Name
- TOR2A (TOR2A Products)
- Background
- The function of TOR2A protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 36 kDa (MW of target protein)
-