TOR2A antibody (N-Term)

Catalog No. ABIN630394

Product Details anti-TOR2A Antibody

Target: TOR2A (Torsin Family 2, Member A (TOR2A))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOR2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TOR2 A antibody was raised against the N terminal of TOR2

Purification: Purified

Immunogen: TOR2 A antibody was raised using the N terminal of TOR2 corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOR2A Blocking Peptide, catalog no. 33R-3388, is also available for use as a blocking control in assays to test for specificity of this TOR2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOR2A

Target: TOR2A (Torsin Family 2, Member A (TOR2A))

Alternative Name: TOR2A (TOR2A Products)

Synonyms: tor2a antibody, TOR2A antibody, zgc:114110 antibody, TORP1 antibody, Prosalusin antibody, Torsin-2A antibody, torsin family 2 member A antibody, torsin family 2, member A L homeolog antibody, torsin family 2, member A antibody, TOR2A antibody, tor2a.L antibody, tor2a antibody, Tor2a antibody

Background: The function of TOR2A protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 36 kDa (MW of target protein)