APMAP antibody (C-Term)

Catalog No. ABIN630391

Product Details anti-APMAP Antibody

Target: APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APMAP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C20 ORF3 antibody was raised against the C terminal Of C20 rf3

Purification: Purified

Immunogen: C20 ORF3 antibody was raised using the C terminal Of C20 rf3 corresponding to a region with amino acids QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF3 Blocking Peptide, catalog no. 33R-7541, is also available for use as a blocking control in assays to test for specificity of this C20ORF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APMAP

Target: APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))

Alternative Name: C20ORF3 (APMAP Products)

Synonyms: BSCv antibody, C20orf3 antibody, C13H20orf3 antibody, 2310001A20Rik antibody, AI314817 antibody, RGD1308874 antibody, bscv antibody, cb351 antibody, wu:fb50a03 antibody, zgc:55833 antibody, zgc:85628 antibody, APMAP antibody, adipocyte plasma membrane associated protein antibody, APMAP antibody, Apmap antibody, apmap antibody

Background: C20orf3 may play a role in adipocyte differentiation.

Molecular Weight: 46 kDa (MW of target protein)