APMAP antibody (C-Term)
-
- Target See all APMAP Antibodies
- APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APMAP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C20 ORF3 antibody was raised against the C terminal Of C20 rf3
- Purification
- Purified
- Immunogen
- C20 ORF3 antibody was raised using the C terminal Of C20 rf3 corresponding to a region with amino acids QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL
- Top Product
- Discover our top product APMAP Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C20ORF3 Blocking Peptide, catalog no. 33R-7541, is also available for use as a blocking control in assays to test for specificity of this C20ORF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APMAP (Adipocyte Plasma Membrane Associated Protein (APMAP))
- Alternative Name
- C20ORF3 (APMAP Products)
- Background
- C20orf3 may play a role in adipocyte differentiation.
- Molecular Weight
- 46 kDa (MW of target protein)
-