TMEM126B antibody (Middle Region)

Catalog No. ABIN630389

Product Details anti-TMEM126B Antibody

Target: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM126B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM126 B antibody was raised against the middle region of TMEM126

Purification: Purified

Immunogen: TMEM126 B antibody was raised using the middle region of TMEM126 corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM126B Blocking Peptide, catalog no. 33R-9538, is also available for use as a blocking control in assays to test for specificity of this TMEM126B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM126B

Target: TMEM126B (Transmembrane Protein 126B (TMEM126B))

Alternative Name: TMEM126B (TMEM126B Products)

Synonyms: 1110001A23Rik antibody, RGD1308371 antibody, transmembrane protein 126B antibody, TMEM126B antibody, Tmem126b antibody

Background: The function of TMEM126B protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 23 kDa (MW of target protein)