KIAA0494 antibody (N-Term)
-
- Target See all KIAA0494 (EFCAB14) Antibodies
- KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIAA0494 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- KIAA0494 antibody was raised against the N terminal of KIAA0494
- Purification
- Purified
- Immunogen
- KIAA0494 antibody was raised using the N terminal of KIAA0494 corresponding to a region with amino acids DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV
- Top Product
- Discover our top product EFCAB14 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIAA0494 Blocking Peptide, catalog no. 33R-2036, is also available for use as a blocking control in assays to test for specificity of this KIAA0494 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0494 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))
- Alternative Name
- KIAA0494 (EFCAB14 Products)
- Background
- KIAA0494 is involved in calcium ion binding.
- Molecular Weight
- 55 kDa (MW of target protein)
-