KIAA0494 antibody (N-Term)

Catalog No. ABIN630388

Product Details anti-KIAA0494 Antibody

Target: KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIAA0494 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KIAA0494 antibody was raised against the N terminal of KIAA0494

Purification: Purified

Immunogen: KIAA0494 antibody was raised using the N terminal of KIAA0494 corresponding to a region with amino acids DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0494 Blocking Peptide, catalog no. 33R-2036, is also available for use as a blocking control in assays to test for specificity of this KIAA0494 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0494 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIAA0494

Target: KIAA0494 (EFCAB14) (EF-hand calcium binding domain 14 (EFCAB14))

Alternative Name: KIAA0494 (EFCAB14 Products)

Synonyms: KIAA0494 antibody, RP11-8J9.3 antibody, 4732418C07Rik antibody, MGC80252 antibody, DKFZp468F099 antibody, RGD1310351 antibody, EF-hand calcium binding domain 14 antibody, EF-hand calcium binding domain 14 S homeolog antibody, EFCAB14 antibody, Efcab14 antibody, efcab14.S antibody, efcab14 antibody

Background: KIAA0494 is involved in calcium ion binding.

Molecular Weight: 55 kDa (MW of target protein)