WSCD2 antibody (C-Term)

Catalog No. ABIN630386

Product Details anti-WSCD2 Antibody

Target: WSCD2 (WSC Domain Containing 2 (WSCD2))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WSCD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WSCD2 antibody was raised against the C terminal of WSCD2

Purification: Purified

Immunogen: WSCD2 antibody was raised using the C terminal of WSCD2 corresponding to a region with amino acids GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPDDYYPR

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WSCD2 Blocking Peptide, catalog no. 33R-3446, is also available for use as a blocking control in assays to test for specificity of this WSCD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WSCD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WSCD2

Target: WSCD2 (WSC Domain Containing 2 (WSCD2))

Alternative Name: WSCD2 (WSCD2 Products)

Synonyms: si:ch211-240b21.1 antibody, 4933413A10Rik antibody, C530024P05Rik antibody, Gm450 antibody, WSC domain containing 2 antibody, WSC domain-containing protein 2 antibody, WSCD2 antibody, MGYG_08833 antibody, MGYG_08830 antibody, wscd2 antibody, Wscd2 antibody

Background: The WSCD2 protein possesses acetylglucosaminyltransferase activity.

Molecular Weight: 64 kDa (MW of target protein)