RCE1/FACE2 antibody

Catalog No. ABIN630380

Product Details anti-RCE1/FACE2 Antibody

Target: RCE1/FACE2 (RCE1) (CAAX Prenyl Protease 2 (RCE1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RCE1/FACE2 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Purified

Immunogen: RCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RCE1 Blocking Peptide, catalog no. 33R-9934, is also available for use as a blocking control in assays to test for specificity of this RCE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RCE1/FACE2

Target: RCE1/FACE2 (RCE1) (CAAX Prenyl Protease 2 (RCE1))

Alternative Name: RCE1 (RCE1 Products)

Synonyms: ARABIDOPSIS THALIANA FARNESYLATED PROTEIN-CONVERTING ENZYME 2 antibody, ARABIDOPSIS THALIANA FARNESYLATED PROTEIN-CONVERTING ENZYME-2 antibody, ATFACE-2 antibody, ATFACE2 antibody, ATRCE1 antibody, RAS-CONVERTING ENZYME 1 antibody, RCE1 antibody, farnesylated protein-converting enzyme 2 antibody, D19Ertd283e antibody, D19Ertd98e antibody, FACE2 antibody, RCE1A antibody, RCE1B antibody, FACE-2 antibody, Ras converting CAAX endopeptidase 1 S homeolog antibody, Ras converting CAAX endopeptidase 1 antibody, farnesylated protein-converting enzyme 2 antibody, rce1.S antibody, RCE1 antibody, FACE2 antibody, Rce1 antibody

Background: RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins.

Molecular Weight: 36 kDa (MW of target protein)