ARMCX6 antibody (N-Term)

Catalog No. ABIN630378

Product Details anti-ARMCX6 Antibody

Target: ARMCX6 (Armadillo Repeat Containing, X-Linked 6 (ARMCX6))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARMCX6 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ARMCX6 antibody was raised against the N terminal of ARMCX6

Purification: Purified

Immunogen: ARMCX6 antibody was raised using the N terminal of ARMCX6 corresponding to a region with amino acids TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARMCX6 Blocking Peptide, catalog no. 33R-9198, is also available for use as a blocking control in assays to test for specificity of this ARMCX6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARMCX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARMCX6

Target: ARMCX6 (Armadillo Repeat Containing, X-Linked 6 (ARMCX6))

Alternative Name: ARMCX6 (ARMCX6 Products)

Synonyms: AW060994 antibody, ARMCX6 antibody, MGC139912 antibody, armadillo repeat containing, X-linked 6 antibody, protein ARMCX6 antibody, ARMCX6 antibody, Armcx6 antibody, LOC100060676 antibody

Background: The function of ARMC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 33 kDa (MW of target protein)