SLC35F2 antibody (N-Term)
-
- Target See all SLC35F2 Antibodies
- SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC35F2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SLC35 F2 antibody was raised against the N terminal of SLC35 2
- Purification
- Purified
- Immunogen
- SLC35 F2 antibody was raised using the N terminal of SLC35 2 corresponding to a region with amino acids MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS
- Top Product
- Discover our top product SLC35F2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC35F2 Blocking Peptide, catalog no. 33R-5885, is also available for use as a blocking control in assays to test for specificity of this SLC35F2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC35F2 (Solute Carrier Family 35, Member F2 (SLC35F2))
- Alternative Name
- SLC35F2 (SLC35F2 Products)
- Synonyms
- HSNOV1 antibody, 1500009K05Rik antibody, AU019213 antibody, solute carrier family 35 member F2 antibody, solute carrier family 35, member F2 antibody, SLC35F2 antibody, Slc35f2 antibody
- Background
- SLC35F2 is a putative solute transporter.
- Molecular Weight
- 41 kDa (MW of target protein)
-