CLCC1 antibody (N-Term)

Catalog No. ABIN630362

Product Details anti-CLCC1 Antibody

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLCC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CLCC1 antibody was raised against the N terminal of CLCC1

Purification: Purified

Immunogen: CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLCC1 Blocking Peptide, catalog no. 33R-6106, is also available for use as a blocking control in assays to test for specificity of this CLCC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLCC1

Target: CLCC1 (Chloride Channel CLIC-Like 1 (CLCC1))

Alternative Name: CLCC1 (CLCC1 Products)

Synonyms: CLCC1 antibody, clcc1 antibody, MCLC antibody, Mclc antibody, chloride channel CLIC like 1 antibody, Chloride channel CLIC-like protein 1 antibody, chloride channel CLIC-like 1 antibody, chloride channel CLIC-like 1 S homeolog antibody, CLCC1 antibody, clcc1 antibody, Clcc1 antibody, clcc1.S antibody

Background: CLCC1 seems to act as a chloride ion channel.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, The Global Phosphorylation Landscape of SARS-CoV-2 Infection