PTRH2 antibody (C-Term)
-
- Target See all PTRH2 Antibodies
- PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTRH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTRH2 antibody was raised against the C terminal of PTRH2
- Purification
- Purified
- Immunogen
- PTRH2 antibody was raised using the C terminal of PTRH2 corresponding to a region with amino acids RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT
- Top Product
- Discover our top product PTRH2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTRH2 Blocking Peptide, catalog no. 33R-8080, is also available for use as a blocking control in assays to test for specificity of this PTRH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTRH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))
- Alternative Name
- PTRH2 (PTRH2 Products)
- Background
- The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
- Molecular Weight
- 20 kDa (MW of target protein)
-