PTRH2 antibody (C-Term)

Catalog No. ABIN630358

Product Details anti-PTRH2 Antibody

Target: PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTRH2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTRH2 antibody was raised against the C terminal of PTRH2

Purification: Purified

Immunogen: PTRH2 antibody was raised using the C terminal of PTRH2 corresponding to a region with amino acids RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTRH2 Blocking Peptide, catalog no. 33R-8080, is also available for use as a blocking control in assays to test for specificity of this PTRH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTRH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTRH2

Target: PTRH2 (Peptidyl-tRNA Hydrolase 2 (PTRH2))

Alternative Name: PTRH2 (PTRH2 Products)

Synonyms: BIT1 antibody, PTH2 antibody, A230072I16Rik antibody, Bit1 antibody, CGI-147 antibody, wu:fj09f02 antibody, zgc:109954 antibody, RGD1306819 antibody, peptidyl-tRNA hydrolase 2 antibody, ptrh2 antibody, CC1G_10259 antibody, ANI_1_1036184 antibody, AOR_1_2082154 antibody, PTRH2 antibody, Ptrh2 antibody

Background: The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.

Molecular Weight: 20 kDa (MW of target protein)