ABCD4 antibody

Catalog No. ABIN630357

Product Details anti-ABCD4 Antibody

Target: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCD4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCD4 Blocking Peptide, catalog no. 33R-2911, is also available for use as a blocking control in assays to test for specificity of this ABCD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCD4

Target: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Alternative Name: ABCD4 (ABCD4 Products)

Synonyms: ABC41 antibody, EST352188 antibody, MAHCJ antibody, P70R antibody, P79R antibody, PMP69 antibody, PXMP1L antibody, Pxmp1l antibody, ABCD4 antibody, zgc:153503 antibody, P69r antibody, ATP binding cassette subfamily D member 4 antibody, ATP-binding cassette, sub-family D (ALD), member 4 antibody, ABCD4 antibody, Abcd4 antibody, abcd4 antibody

Background: ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis.

Molecular Weight: 55 kDa (MW of target protein)