SLC26A5 antibody
-
- Target See all SLC26A5 Antibodies
- SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC26A5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SLC26 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC26A5 Blocking Peptide, catalog no. 33R-3083, is also available for use as a blocking control in assays to test for specificity of this SLC26A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC26A5 (Solute Carrier Family 26, Member 5 (Prestin) (SLC26A5))
- Alternative Name
- SLC26A5 (SLC26A5 Products)
- Background
- SLC26A5 is a member of the SLC26A/SulP transporter family. SLC26A5 is specifically expressed in outer hair cells (OHCs) of the cochlea and is essential in auditory processing. Intracellular anions are thought to act as extrinsic voltage sensors, which bind to this protein and trigger the conformational changes required for rapid length changes in OHCs. Mutations in its gene have been associated with non-syndromic hearing loss.
- Molecular Weight
- 81 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Dicarboxylic Acid Transport
-