TRIM59 antibody (Middle Region)
-
- Target See all TRIM59 Antibodies
- TRIM59 (Tripartite Motif Containing 59 (TRIM59))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRIM59 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- TRIM59 antibody was raised against the middle region of TRIM59
- Purification
- Purified
- Immunogen
- TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
- Top Product
- Discover our top product TRIM59 Primary Antibody
-
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibody
TRIM59 Reactivity: Human, Mouse, Rat ELISA, WB, IHC, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 68-96), (N-Term) antibodyTRIM59 Reactivity: Human WB, IF, IHC (p) Host: Rabbit Polyclonal RB29690 unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 251-300) antibodyTRIM59 Reactivity: Human, Mouse, Rat, Horse, Pig, Monkey WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 191-240) antibodyTRIM59 Reactivity: Human, Mouse ELISA, WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibodyTRIM59 Reactivity: Human, Mouse WB, IF, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibodyTRIM59 Reactivity: Human ELISA, WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 126-181) antibodyTRIM59 Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (Internal Region) antibodyTRIM59 Reactivity: Human, Mouse ELISA, WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (AA 51-100) antibodyTRIM59 Reactivity: Human, Horse, Pig, Cow, Rabbit, Monkey, Bat WB Host: Rabbit Polyclonal unconjugated
anti-Tripartite Motif Containing 59 (TRIM59) (N-Term) antibodyTRIM59 Reactivity: Human, Dog WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRIM59 Blocking Peptide, catalog no. 33R-4912, is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM59 (Tripartite Motif Containing 59 (TRIM59))
- Alternative Name
- TRIM59 (TRIM59 Products)
- Synonyms
- zgc:193694 antibody, zgc:193700 antibody, TRIM59 antibody, MRF1 antibody, RNF104 antibody, TRIM57 antibody, TSBF1 antibody, 2310035M22Rik antibody, 2700022F13Rik antibody, Mrf1 antibody, RGD1311956 antibody, LYR motif containing 9 antibody, tripartite motif containing 59 antibody, tripartite motif-containing 59 antibody, lyrm9 antibody, TRIM59 antibody, Trim59 antibody
- Background
- The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-
