RNF121 antibody (N-Term)

Catalog No. ABIN630351

Product Details anti-RNF121 Antibody

Target: RNF121 (Ring Finger Protein 121 (RNF121))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF121 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RNF121 antibody was raised against the N terminal of RNF121

Purification: Purified

Immunogen: RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF121 Blocking Peptide, catalog no. 33R-10040, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF121 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF121

Target: RNF121 (Ring Finger Protein 121 (RNF121))

Alternative Name: RNF121 (RNF121 Products)

Synonyms: 4930544L10Rik antibody, im:6907121 antibody, si:ch73-373k7.1 antibody, ring finger protein 121 antibody, RING finger protein 121 antibody, RNF121 antibody, rnf-121 antibody, Rnf121 antibody, rnf121 antibody

Background: The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling