UBE2J2 antibody

Catalog No. ABIN630350

Product Details anti-UBE2J2 Antibody

Target: UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2J2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: UBE2 J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2J2 Blocking Peptide, catalog no. 33R-3342, is also available for use as a blocking control in assays to test for specificity of this UBE2J2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2J2

Target: UBE2J2 (Ubiquitin-Conjugating Enzyme E2, J2 (UBE2J2))

Alternative Name: UBE2J2 (UBE2J2 Products)

Synonyms: NCUBE-2 antibody, NCUBE2 antibody, PRO2121 antibody, 1200007B18Rik antibody, 2400008G19Rik antibody, 5730472G04Rik antibody, AL022923 antibody, Ubc6 antibody, Ubc6p antibody, zgc:162164 antibody, ubiquitin conjugating enzyme E2 J2 antibody, ubiquitin-conjugating enzyme E2J 2 antibody, ubiquitin-conjugating enzyme E2, J2 antibody, ubiquitin-conjugating enzyme E2 J2 antibody, ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) antibody, ubiquitin conjugating enzyme E2 J2 L homeolog antibody, UBE2J2 antibody, Ube2j2 antibody, LOC5574000 antibody, CpipJ_CPIJ008956 antibody, ube2j2 antibody, uce2 antibody, ube2j2.L antibody, LOC100067387 antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.

Molecular Weight: 30 kDa (MW of target protein)