SGCG antibody

Catalog No. ABIN630345

Product Details anti-SGCG Antibody

Target: SGCG (Sarcoglycan, gamma (35kDa Dystrophin-Associated Glycoprotein) (SGCG))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SGCG antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SGCG Blocking Peptide, catalog no. 33R-3107, is also available for use as a blocking control in assays to test for specificity of this SGCG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SGCG

Target: SGCG (Sarcoglycan, gamma (35kDa Dystrophin-Associated Glycoprotein) (SGCG))

Alternative Name: SGCG (SGCG Products)

Background: Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).

Molecular Weight: 32 kDa (MW of target protein)