AGPAT2 antibody (C-Term)

Catalog No. ABIN630343

Product Details anti-AGPAT2 Antibody

Target: AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGPAT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AGPAT2 antibody was raised against the C terminal of AGPAT2

Purification: Purified

Immunogen: AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGPAT2 Blocking Peptide, catalog no. 33R-4874, is also available for use as a blocking control in assays to test for specificity of this AGPAT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGPAT2

Target: AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))

Alternative Name: AGPAT2 (AGPAT2 Products)

Synonyms: AGPAT2 antibody, zgc:153984 antibody, 1-agpat2 antibody, bscl antibody, bscl1 antibody, lpaab antibody, lpaat-beta antibody, 1-AGPAT2 antibody, BSCL antibody, BSCL1 antibody, LPAAB antibody, LPAAT-beta antibody, 2510002J07Rik antibody, AV000834 antibody, 1-acylglycerol-3-phosphate O-acyltransferase 2 antibody, 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) antibody, AGPAT2 antibody, agpat2 antibody, Agpat2 antibody

Background: AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.

Molecular Weight: 27 kDa (MW of target protein)