AGPAT2 antibody (C-Term)
-
- Target See all AGPAT2 Antibodies
- AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AGPAT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AGPAT2 antibody was raised against the C terminal of AGPAT2
- Purification
- Purified
- Immunogen
- AGPAT2 antibody was raised using the C terminal of AGPAT2 corresponding to a region with amino acids LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA
- Top Product
- Discover our top product AGPAT2 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AGPAT2 Blocking Peptide, catalog no. 33R-4874, is also available for use as a blocking control in assays to test for specificity of this AGPAT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AGPAT2 (1-Acylglycerol-3-Phosphate O-Acyltransferase 2 (Lysophosphatidic Acid Acyltransferase, Beta) (AGPAT2))
- Alternative Name
- AGPAT2 (AGPAT2 Products)
- Background
- AGPAT2 is a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in its gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance.
- Molecular Weight
- 27 kDa (MW of target protein)
-