SLC1A5 antibody

Catalog No. ABIN630342

Product Details anti-SLC1A5 Antibody

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC1A5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC1A5 Blocking Peptide, catalog no. 33R-2915, is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-SLC1A5 antibody (ABIN630342)

Krämer, Gröner, Hoffmann, Craig, Brugger, Drzezga, Timmer, Neumaier, Zlatopolskiy, Endepols, Neumaier: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." in: Cancers, Vol. 13, Issue 23, (2021) (PubMed).

Target Details for SLC1A5

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Alternative Name: SLC1A5 (SLC1A5 Products)

Synonyms: aaat antibody, asct2 antibody, atbo antibody, m7v1 antibody, m7vs1 antibody, r16 antibody, rdrc antibody, AAAT antibody, ASCT2 antibody, ATBO antibody, M7V1 antibody, M7VS1 antibody, R16 antibody, RDRC antibody, Slc1a7 antibody, Asct2 antibody, H4-ASCT2 antibody, solute carrier family 1 (neutral amino acid transporter), member 5 antibody, solute carrier family 1 member 5 S homeolog antibody, solute carrier family 1 member 5 antibody, slc1a5 antibody, slc1a5.S antibody, SLC1A5 antibody, Slc1a5 antibody

Background: SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport, Warburg Effect