SLC1A5 antibody

Catalog No. ABIN630342

Product Details anti-SLC1A5 Antibody

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC1A5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC1A5 Blocking Peptide, catalog no. 33R-2915, is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-SLC1A5 antibody (ABIN630342)

Krämer, Gröner, Hoffmann, Craig, Brugger, Drzezga, Timmer, Neumaier, Zlatopolskiy, Endepols, Neumaier: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." in: Cancers, Vol. 13, Issue 23, (2021) (PubMed).

Target Details for SLC1A5

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Alternative Name: SLC1A5 (SLC1A5 Products)

Background: SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport, Warburg Effect