SRPRB antibody (C-Term)

Catalog No. ABIN630341

Product Details anti-SRPRB Antibody

Target: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRPRB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SRPRB antibody was raised against the C terminal of SRPRB

Purification: Purified

Immunogen: SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRPRB Blocking Peptide, catalog no. 33R-1415, is also available for use as a blocking control in assays to test for specificity of this SRPRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRPRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRPRB

Target: SRPRB (Signal Recognition Particle Receptor, B Subunit (SRPRB))

Alternative Name: SRPRB (SRPRB Products)

Synonyms: wu:fk57h10 antibody, zgc:111820 antibody, zgc:92746 antibody, apmcf1 antibody, APMCF1 antibody, AA409543 antibody, Ab2-417 antibody, Ba1-667 antibody, Cc1-8 antibody, signal recognition particle receptor, B subunit antibody, SRP receptor beta subunit S homeolog antibody, SRP receptor beta subunit antibody, SRPRB antibody, srprb antibody, srprb.S antibody, Srprb antibody

Background: SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling