S1PR5 antibody (N-Term)

Catalog No. ABIN630339

Product Details anti-S1PR5 Antibody

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog, Drosophila melanogaster, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This S1PR5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: EDG8 antibody was raised against the N terminal of EDG8

Purification: Purified

Immunogen: EDG8 antibody was raised using the N terminal of EDG8 corresponding to a region with amino acids MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFI

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EDG8 Blocking Peptide, catalog no. 33R-5958, is also available for use as a blocking control in assays to test for specificity of this EDG8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for S1PR5

Target: S1PR5 (Sphingosine-1-Phosphate Receptor 5 (S1PR5))

Alternative Name: EDG8 (S1PR5 Products)

Synonyms: EDG8 antibody, Edg-8 antibody, S1P5 antibody, SPPR-1 antibody, SPPR-2 antibody, fd11a07 antibody, wu:fd11a07 antibody, zgc:92296 antibody, edg-8 antibody, edg8 antibody, s1p5 antibody, sppr-1 antibody, sppr-2 antibody, xts1p5 antibody, Edg8 antibody, lpB4 antibody, zgc:158362 antibody, sphingosine-1-phosphate receptor 5 antibody, sphingosine-1-phosphate receptor 5a antibody, sphingosine-1-phosphate receptor 5b antibody, S1PR5 antibody, s1pr5a antibody, s1pr5 antibody, S1pr5 antibody, s1pr5b antibody

Background: EDG8 is a receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. It Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). It may play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.

Molecular Weight: 16 kDa (MW of target protein)