SEC63 antibody

Catalog No. ABIN630338

Product Details anti-SEC63 Antibody

Target: SEC63 (SEC63 Homolog (SEC63))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEC63 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEC63 Blocking Peptide, catalog no. 33R-10039, is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEC63

Target: SEC63 (SEC63 Homolog (SEC63))

Alternative Name: SEC63 (SEC63 Products)

Synonyms: DNAJC23 antibody, ERdj2 antibody, PRO2507 antibody, SEC63L antibody, 5730478J10Rik antibody, AI649014 antibody, AW319215 antibody, SEC63-like antibody, zgc:92718 antibody, SEC63 homolog, protein translocation regulator antibody, SEC63-like (S. cerevisiae) antibody, SEC63 homolog, protein translocation regulator L homeolog antibody, SEC63 antibody, Sec63 antibody, sec63 antibody, sec63.L antibody

Background: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling