SLC41A2 antibody (N-Term)
-
- Target See all SLC41A2 Antibodies
- SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC41A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC41 A2 antibody was raised against the N terminal of SLC41 2
- Purification
- Purified
- Immunogen
- SLC41 A2 antibody was raised using the N terminal of SLC41 2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK
- Top Product
- Discover our top product SLC41A2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC41A2 Blocking Peptide, catalog no. 33R-8340, is also available for use as a blocking control in assays to test for specificity of this SLC41A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC41A2 (Solute Carrier Family 41, Member 2 (SLC41A2))
- Alternative Name
- SLC41A2 (SLC41A2 Products)
- Synonyms
- MGC83802 antibody, slc41a1-l1 antibody, SLC41A1-L1 antibody, A230035L05Rik antibody, solute carrier family 41 member 2 antibody, solute carrier family 41 member 2 L homeolog antibody, solute carrier family 41, member 2 antibody, Slc41a2 antibody, slc41a2.L antibody, SLC41A2 antibody, slc41a2 antibody
- Background
- SLC41A2 acts as a plasma-membrane magnesium transporter.
- Molecular Weight
- 53 kDa (MW of target protein)
-