Pannexin 2 antibody (N-Term)

Catalog No. ABIN630334

Product Details anti-Pannexin 2 Antibody

Target: Pannexin 2 (PANX2)

Binding Specificity: N-Term

Reactivity: Mammalian

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Pannexin 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Pannexin 2 antibody was raised against the N terminal of PANX2

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio)

Purification: Purified

Immunogen: Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Pannexin 2 Blocking Peptide, catalog no. 33R-3625, is also available for use as a blocking control in assays to test for specificity of this Pannexin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Pannexin 2

Target: Pannexin 2 (PANX2)

Alternative Name: Pannexin 2 (PANX2 Products)

Synonyms: PANX2 antibody, si:ch211-192n14.2 antibody, PX2 antibody, hPANX2 antibody, pannexin 2 antibody, PANX2 antibody, LOC100533356 antibody, panx2 antibody, Panx2 antibody

Background: PANX2 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties.

Molecular Weight: 70 kDa (MW of target protein)