Fukutin antibody (N-Term)

Catalog No. ABIN630326

Product Details anti-Fukutin Antibody

Target: Fukutin (FKTN)

Binding Specificity: N-Term

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fukutin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: FKTN antibody was raised against the N terminal Of Fktn

Purification: Purified

Immunogen: FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKTN Blocking Peptide, catalog no. 33R-8971, is also available for use as a blocking control in assays to test for specificity of this FKTN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fukutin

Target: Fukutin (FKTN)

Alternative Name: FKTN (FKTN Products)

Synonyms: FCMD antibody, fcmd antibody, im:7163166 antibody, zgc:162828 antibody, FKTN antibody, CMD1X antibody, LGMD2M antibody, MDDGA4 antibody, MDDGB4 antibody, MDDGC4 antibody, D830030O17Rik antibody, Fcmd antibody, fukutin antibody, fukutin S homeolog antibody, Fukutin antibody, FKTN antibody, fktn antibody, fktn.S antibody, Bm1_09375 antibody, Bm1_09380 antibody, Bm1_44655 antibody, Fktn antibody

Background: FKTN regulates the migration and assembly of neurons during cortical histogenesis. Fukuyama congenital muscular dystrophy results from mutations in its gene.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process