LETM1 antibody (Middle Region)
-
- Target See all LETM1 Antibodies
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LETM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LETM1 antibody was raised against the middle region of LETM1
- Purification
- Purified
- Immunogen
- LETM1 antibody was raised using the middle region of LETM1 corresponding to a region with amino acids MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
- Top Product
- Discover our top product LETM1 Primary Antibody
-
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (C-Term) antibody
LETM1 Reactivity: Human, Mouse WB, IF, IHC (p), ICC Host: Rabbit Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 601-708) antibodyLETM1 Reactivity: Human WB, ELISA, IF, IP, IHC (p) Host: Mouse Monoclonal 6F7 unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 1-739) antibodyLETM1 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 443-543) antibodyLETM1 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (Internal Region) antibodyLETM1 Reactivity: Human, Mouse, Rat WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 1-739) antibodyLETM1 Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 601-708) antibodyLETM1 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 577-607), (C-Term) antibodyLETM1 Reactivity: Human WB Host: Rabbit Polyclonal RB37176 unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 271-320) antibodyLETM1 Reactivity: Human, Mouse, Rat, Dog, Cow, Guinea Pig, Horse, Rabbit, Pig, Bat, Chicken, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1) (AA 1-140) antibodyLETM1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LETM1 Blocking Peptide, catalog no. 33R-5689, is also available for use as a blocking control in assays to test for specificity of this LETM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LETM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LETM1 (Leucine Zipper-EF-Hand Containing Transmembrane Protein 1 (LETM1))
- Alternative Name
- LETM1 (LETM1 Products)
- Synonyms
- LETM1 antibody, wu:fc31h08 antibody, wu:fc58h01 antibody, zgc:109969 antibody, letm1 antibody, MGC145623 antibody, leucine zipper and EF-hand containing transmembrane protein 1 antibody, leucine zipper-EF-hand containing transmembrane protein 1 antibody, LETM1 and EF-hand domain-containing protein 1, mitochondrial antibody, LETM1 antibody, letm1 antibody, LOC100346816 antibody, Letm1 antibody
- Background
- The LETM1 is a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.
- Molecular Weight
- 60 kDa (MW of target protein)
-
