COX15 antibody
-
- Target See all COX15 Antibodies
- COX15 (Cytochrome C Oxidase Assembly Homolog 15 (COX15))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This COX15 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Purification
- Purified
- Immunogen
- COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
- Top Product
- Discover our top product COX15 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
COX15 Blocking Peptide, catalog no. 33R-2231, is also available for use as a blocking control in assays to test for specificity of this COX15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COX15 (Cytochrome C Oxidase Assembly Homolog 15 (COX15))
- Alternative Name
- COX15 (COX15 Products)
- Synonyms
- COX15 antibody, wu:fa18g06 antibody, zgc:56240 antibody, zgc:77422 antibody, 2900026G05Rik antibody, CEMCOX2 antibody, COX15, cytochrome c oxidase assembly homolog antibody, COX15 homolog, cytochrome c oxidase assembly protein (yeast) antibody, COX15 cytochrome c oxidase assembly homolog antibody, cytochrome c oxidase assembly homolog 15 (yeast) antibody, cytochrome c oxidase assembly protein 15 antibody, cytochrome c oxidase assembly protein COX15 homolog antibody, COX15 antibody, Cox15 antibody, cox15 antibody, LOC100410987 antibody, LOC100599631 antibody
- Background
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.
- Molecular Weight
- 44 kDa (MW of target protein)
-