LY6G6F antibody (N-Term)

Catalog No. ABIN630316

Product Details anti-LY6G6F Antibody

Target: LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LY6G6F antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: C6 ORF21 antibody was raised against the N terminal Of C6 rf21

Purification: Purified

Immunogen: C6 ORF21 antibody was raised using the N terminal Of C6 rf21 corresponding to a region with amino acids CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF21 Blocking Peptide, catalog no. 33R-1813, is also available for use as a blocking control in assays to test for specificity of this C6ORF21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LY6G6F

Target: LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))

Alternative Name: C6ORF21 (LY6G6F Products)

Synonyms: C6orf21 antibody, G6f antibody, LY6G6D antibody, NG32 antibody, CJ068215 antibody, C6ORF21 antibody, lymphocyte antigen 6 family member G6F antibody, lymphocyte antigen 6 complex, locus G6F antibody, LY6G6F antibody, Ly6g6f antibody

Background: C6ORF21 may play a role in the downstream signal transduction pathways involving GRB2 and GRB7.

Molecular Weight: 31 kDa (MW of target protein)