SLC22A23 antibody (Middle Region)
-
- Target See all SLC22A23 Antibodies
- SLC22A23 (Solute Carrier Family 22 (Organic Cation Transporter), Member 23 (SLC22A23))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A23 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC22 A23 antibody was raised against the middle region of SLC22 23
- Purification
- Purified
- Immunogen
- SLC22 A23 antibody was raised using the middle region of SLC22 23 corresponding to a region with amino acids VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL
- Top Product
- Discover our top product SLC22A23 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A23 Blocking Peptide, catalog no. 33R-9884, is also available for use as a blocking control in assays to test for specificity of this SLC22A23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A23 (Solute Carrier Family 22 (Organic Cation Transporter), Member 23 (SLC22A23))
- Alternative Name
- SLC22A23 (SLC22A23 Products)
- Synonyms
- SLC22A23 antibody, C6orf85 antibody, 3110004L20Rik antibody, Nritp antibody, solute carrier family 22 member 23 antibody, solute carrier family 22, member 23 antibody, SLC22A23 antibody, Slc22a23 antibody
- Background
- SLC22A23 belongs to a large family of transmembrane proteins that function as uniporters, symporters, and antiporters to transport organic ions across cell membranes.
- Molecular Weight
- 45 kDa (MW of target protein)
-