NrCAM antibody (N-Term)

Catalog No. ABIN630314

Product Details anti-NrCAM Antibody

Target: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NrCAM antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: NRCAM antibody was raised against the N terminal of NRCAM

Purification: Purified

Immunogen: NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRCAM Blocking Peptide, catalog no. 33R-6774, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NrCAM

Target: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Alternative Name: NRCAM (NRCAM Products)

Synonyms: CD56 antibody, MSK39 antibody, NCAM antibody, Bravo antibody, C030017F07Rik antibody, C130076O07Rik antibody, mKIAA0343 antibody, NRCAM antibody, si:dkey-240a12.1 antibody, Nr-CAM antibody, neural cell adhesion molecule 1 antibody, neuronal cell adhesion molecule antibody, neuronal cell adhesion molecule L homeolog antibody, neuronal cell adhesion molecule a antibody, NCAM1 antibody, NRCAM antibody, Nrcam antibody, nrcam.L antibody, nrcama antibody, nrcam antibody

Background: Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

Molecular Weight: 141 kDa (MW of target protein)

Pathways: Regulation of Cell Size