SLC25A29 antibody (C-Term)

Catalog No. ABIN630313

Product Details anti-SLC25A29 Antibody

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A29 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC25 A29 antibody was raised against the C terminal of SLC25 29

Purification: Purified

Immunogen: SLC25 A29 antibody was raised using the C terminal of SLC25 29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A29 Blocking Peptide, catalog no. 33R-1129, is also available for use as a blocking control in assays to test for specificity of this SLC25A29 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A29

Target: SLC25A29 (Solute Carrier Family 25, Member 29 (SLC25A29))

Alternative Name: SLC25A29 (SLC25A29 Products)

Synonyms: zgc:114094 antibody, SLC25A29 antibody, slc25a29 antibody, MGC122743 antibody, C14orf69 antibody, CACL antibody, ORNT3 antibody, C030003J19Rik antibody, mCACL antibody, solute carrier family 25 member 29 antibody, solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 L homeolog antibody, solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 antibody, solute carrier family 25 (mitochondrial carrier, palmitoylcarnitine transporter), member 29 antibody, SLC25A29 antibody, slc25a29.L antibody, slc25a29 antibody, Slc25a29 antibody

Background: SLC25A29 belongs to the mitochondrial carrier family and it may has palmitoylcarnitine transporting activity.

Molecular Weight: 33 kDa (MW of target protein)