KIAA0319 antibody (N-Term)

Catalog No. ABIN630311

Product Details anti-KIAA0319 Antibody

Target: KIAA0319

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIAA0319 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KIAA0319 antibody was raised against the N terminal of KIAA0319

Purification: Purified

Immunogen: KIAA0319 antibody was raised using the N terminal of KIAA0319 corresponding to a region with amino acids EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0319 Blocking Peptide, catalog no. 33R-2376, is also available for use as a blocking control in assays to test for specificity of this KIAA0319 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0319 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIAA0319

Target: KIAA0319

Alternative Name: KIAA0319 (KIAA0319 Products)

Synonyms: DYLX2 antibody, DYX2 antibody, 4930451E12Rik antibody, Kiaa0319 antibody, KIAA0319 antibody, RIKEN cDNA D130043K22 gene antibody, KIAA0319 ortholog antibody, similar to mKIAA0319 protein antibody, KIAA0319 antibody, D130043K22Rik antibody, RGD1307443 antibody

Background: KIAA0319 has been strongly associated with developmental dyslexia.

Molecular Weight: 56 kDa (MW of target protein)