MGC39633 (N-Term) antibody
-
- Target
- MGC39633
- Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificity
- MGC39633 antibody was raised against the N terminal Of Mgc39633
- Purification
- Purified
- Immunogen
- MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE
-
anti-MGC39633 (N-Term) antibody
Reactivity: Human, Rabbit, Rat, Cow, Horse, Mouse, Pig IHC, WB Host: Rabbit Polyclonal unconjugated
anti-MGC39633 antibodyReactivity: Human, Dog IHC, WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGC39633 Blocking Peptide, catalog no. 33R-9790, is also available for use as a blocking control in assays to test for specificity of this MGC39633 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC39633 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGC39633
- Background
- The function of MGC39633 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 62 kDa (MW of target protein)
-
