SC4MOL antibody (N-Term)
-
- Target See all SC4MOL (MSMO1) Antibodies
- SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SC4MOL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SC4 MOL antibody was raised against the N terminal of SC4 OL
- Purification
- Purified
- Immunogen
- SC4 MOL antibody was raised using the N terminal of SC4 OL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
- Top Product
- Discover our top product MSMO1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SC4MOL Blocking Peptide, catalog no. 33R-5780, is also available for use as a blocking control in assays to test for specificity of this SC4MOL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SC0 OL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SC4MOL (MSMO1) (Methylsterol Monooxygenase 1 (MSMO1))
- Alternative Name
- SC4MOL (MSMO1 Products)
- Background
- Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.
- Molecular Weight
- 35 kDa (MW of target protein)
-