SLC12A2 antibody

Catalog No. ABIN630304

Product Details anti-SLC12A2 Antibody

Target: SLC12A2 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC12A2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SLC12 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC12A2 Blocking Peptide, catalog no. 33R-3991, is also available for use as a blocking control in assays to test for specificity of this SLC12A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC12A2

Target: SLC12A2 (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 2 (SLC12A2))

Alternative Name: SLC12A2 (SLC12A2 Products)

Synonyms: BSC antibody, BSC2 antibody, NKCC1 antibody, Bsc2 antibody, Nkcc1 antibody, bsc2 antibody, 9330166H04Rik antibody, mBSC2 antibody, sy-ns antibody, solute carrier family 12 member 2 antibody, solute carrier family 12, member 2 antibody, SLC12A2 antibody, Slc12a2 antibody

Background: By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.

Molecular Weight: 131 kDa (MW of target protein)

Pathways: Sensory Perception of Sound