ZFYVE27 antibody (C-Term)
-
- Target See all ZFYVE27 Antibodies
- ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZFYVE27 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZFYVE27 antibody was raised against the C terminal of ZFYVE27
- Purification
- Purified
- Immunogen
- ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC
- Top Product
- Discover our top product ZFYVE27 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZFYVE27 Blocking Peptide, catalog no. 33R-9076, is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))
- Alternative Name
- ZFYVE27 (ZFYVE27 Products)
- Background
- ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway
-