ZFYVE27 antibody (C-Term)

Catalog No. ABIN630303

Product Details anti-ZFYVE27 Antibody

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Binding Specificity: C-Term

Reactivity: Human, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZFYVE27 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZFYVE27 antibody was raised against the C terminal of ZFYVE27

Purification: Purified

Immunogen: ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZFYVE27 Blocking Peptide, catalog no. 33R-9076, is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZFYVE27

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Alternative Name: ZFYVE27 (ZFYVE27 Products)

Background: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway