ZFYVE27 antibody (Middle Region)

Catalog No. ABIN630302

Product Details anti-ZFYVE27 Antibody

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZFYVE27 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZFYVE27 antibody was raised against the middle region of ZFYVE27

Purification: Purified

Immunogen: ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZFYVE27 Blocking Peptide, catalog no. 33R-9554, is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZFYVE27

Target: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Alternative Name: ZFYVE27 (ZFYVE27 Products)

Synonyms: ZFYVE27 antibody, MGC130947 antibody, spg33 antibody, im:7137347 antibody, zgc:153156 antibody, PROTRUDIN antibody, RP11-459F3.2 antibody, SPG33 antibody, 2210011N02Rik antibody, 9530077C24Rik antibody, AI426636 antibody, AI593546 antibody, AI835681 antibody, zinc finger FYVE-type containing 27 antibody, zinc finger FYVE domain containing 27 L homeolog antibody, zinc finger FYVE domain containing 27 antibody, zinc finger, FYVE domain containing 27 antibody, ZFYVE27 antibody, zfyve27.L antibody, zfyve27 antibody, Zfyve27 antibody

Background: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway