MFAP3L antibody (N-Term)
-
- Target See all MFAP3L Antibodies
- MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MFAP3L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MFAP3 L antibody was raised against the N terminal of MFAP3
- Purification
- Purified
- Immunogen
- MFAP3 L antibody was raised using the N terminal of MFAP3 corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
- Top Product
- Discover our top product MFAP3L Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MFAP3L Blocking Peptide, catalog no. 33R-6090, is also available for use as a blocking control in assays to test for specificity of this MFAP3L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))
- Alternative Name
- MFAP3L (MFAP3L Products)
- Background
- The function of MFAP3L protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 45 kDa (MW of target protein)
-