MFAP3L antibody (N-Term)

Catalog No. ABIN630299

Product Details anti-MFAP3L Antibody

Target: MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFAP3L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MFAP3 L antibody was raised against the N terminal of MFAP3

Purification: Purified

Immunogen: MFAP3 L antibody was raised using the N terminal of MFAP3 corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFAP3L Blocking Peptide, catalog no. 33R-6090, is also available for use as a blocking control in assays to test for specificity of this MFAP3L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFAP3L

Target: MFAP3L (Microfibrillar-Associated Protein 3-Like (MFAP3L))

Alternative Name: MFAP3L (MFAP3L Products)

Synonyms: NYD-sp9 antibody, 4933428A15Rik antibody, 5430405D20Rik antibody, AI461995 antibody, AW125052 antibody, mKIAA0626 antibody, microfibril associated protein 3 like antibody, microfibril associated protein 3 like S homeolog antibody, microfibrillar associated protein 3 like antibody, microfibrillar-associated protein 3-like antibody, MFAP3L antibody, mfap3l.S antibody, Mfap3l antibody

Background: The function of MFAP3L protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 45 kDa (MW of target protein)