TMEM104 antibody (Middle Region)
-
- Target See all TMEM104 products
- TMEM104 (Transmembrane Protein 104 (TMEM104))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM104 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM104 antibody was raised against the middle region of TMEM104
- Purification
- Purified
- Immunogen
- TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM104 Blocking Peptide, catalog no. 33R-3200, is also available for use as a blocking control in assays to test for specificity of this TMEM104 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM104 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM104 (Transmembrane Protein 104 (TMEM104))
- Alternative Name
- TMEM104 (TMEM104 Products)
- Synonyms
- RGD1307953 antibody, C630005D06Rik antibody, mFLJ00021 antibody, transmembrane protein 104 antibody, CpipJ_CPIJ018706 antibody, CpipJ_CPIJ018704 antibody, TMEM104 antibody, Tmem104 antibody
- Background
- The function of TMEM104 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 35 kDa (MW of target protein)
-