SDCBP antibody
-
- Target See all SDCBP Antibodies
- SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SDCBP antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV
- Top Product
- Discover our top product SDCBP Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SDCBP Blocking Peptide, catalog no. 33R-9561, is also available for use as a blocking control in assays to test for specificity of this SDCBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDCBP (Syndecan Binding Protein (Syntenin) (SDCBP))
- Alternative Name
- SDCBP (SDCBP Products)
- Synonyms
- MDA-9 antibody, ST1 antibody, SYCL antibody, TACIP18 antibody, Sycl antibody, syntenin-1 antibody, mda-9 antibody, st1 antibody, sycl antibody, tacip18 antibody, MGC81274 antibody, syntenin antibody, wu:fc51c03 antibody, wu:fk31e01 antibody, zgc:55679 antibody, zgc:77716 antibody, sb:eu862 antibody, si:dkey-235k4.1 antibody, syndecan binding protein antibody, syndecan binding protein L homeolog antibody, syndecan binding protein (syntenin) 2 antibody, syndecan binding protein (syntenin) antibody, SDCBP antibody, Sdcbp antibody, sdcbp.L antibody, LOC732879 antibody, sdcbp2 antibody, sdcbp antibody
- Background
- SDCBP was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.
- Molecular Weight
- 32 kDa (MW of target protein)
-