-
- Target See all ITGBL1 Antibodies
- ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ITGBL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR
- Top Product
- Discover our top product ITGBL1 Primary Antibody
-
anti-Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) (AA 334-360) antibody
ITGBL1 Reactivity: Human WB, FACS, IHC (p) Host: Rabbit Polyclonal RB23638 unconjugated
anti-Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) antibodyITGBL1 Reactivity: Human WB, FACS, IHC Host: Rabbit Polyclonal unconjugated
anti-Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) (N-Term) antibodyITGBL1 Reactivity: Human, Dog, Mouse, Horse, Pig, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) (AA 151-200) antibodyITGBL1 Reactivity: Human, Dog, Mouse, Rat, Guinea Pig, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) (AA 200-300) antibodyITGBL1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ITGBL1 Blocking Peptide, catalog no. 33R-6373, is also available for use as a blocking control in assays to test for specificity of this ITGBL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGBL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITGBL1 (Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1))
- Alternative Name
- ITGBL1 (ITGBL1 Products)
- Synonyms
- ITGBL1 antibody, B930011D01Rik antibody, OSCP antibody, TIED antibody, integrin subunit beta like 1 antibody, integrin, beta-like 1 antibody, integrin subunit beta like 1 L homeolog antibody, ITGBL1 antibody, Itgbl1 antibody, itgbl1.L antibody
- Background
- The function of ITGBL1 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 54 kDa (MW of target protein)
-
You are here:
