CLDN8 antibody (C-Term)
-
- Target See all CLDN8 Antibodies
- CLDN8 (Claudin 8 (CLDN8))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLDN8 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Claudin 8 antibody was raised against the C terminal of CLDN8
- Purification
- Purified
- Immunogen
- Claudin 8 antibody was raised using the C terminal of CLDN8 corresponding to a region with amino acids IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
- Top Product
- Discover our top product CLDN8 Primary Antibody
-
-
- Application Notes
-
WB: 0.5-1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Claudin 8 Blocking Peptide, catalog no. 33R-4198, is also available for use as a blocking control in assays to test for specificity of this Claudin 8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLDN8 (Claudin 8 (CLDN8))
- Alternative Name
- Claudin 8 (CLDN8 Products)
- Synonyms
- zgc:91900 antibody, wu:fa01e05 antibody, CLDN8 antibody, AI648025 antibody, claudin 8 antibody, CLDN8 antibody, cldn8 antibody, Cldn8 antibody
- Background
- CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Hepatitis C
-