Claudin 17 antibody (Middle Region)

Catalog No. ABIN630266

Product Details anti-Claudin 17 Antibody

Target: Claudin 17 (CLDN17)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 17 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Claudin 17 antibody was raised against the middle region of CLDN17

Purification: Purified

Immunogen: Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Application Details

Application Notes: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 17 Blocking Peptide, catalog no. 33R-4616, is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 17

Target: Claudin 17 (CLDN17)

Alternative Name: Claudin 17 (CLDN17 Products)

Synonyms: CLDN17 antibody, Claudin-17 antibody, zgc:173444 antibody, claudin 17 antibody, CLDN17 antibody, cldn17 antibody, Cldn17 antibody

Background: CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C