Claudin 17 antibody (Middle Region)
-
- Target See all Claudin 17 (CLDN17) Antibodies
- Claudin 17 (CLDN17)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Claudin 17 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Claudin 17 antibody was raised against the middle region of CLDN17
- Purification
- Purified
- Immunogen
- Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
- Top Product
- Discover our top product CLDN17 Primary Antibody
-
-
- Application Notes
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Claudin 17 Blocking Peptide, catalog no. 33R-4616, is also available for use as a blocking control in assays to test for specificity of this Claudin 17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 17 (CLDN17)
- Alternative Name
- Claudin 17 (CLDN17 Products)
- Synonyms
- CLDN17 antibody, Claudin-17 antibody, zgc:173444 antibody, claudin 17 antibody, CLDN17 antibody, cldn17 antibody, Cldn17 antibody
- Background
- CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-