CLDN10 antibody (C-Term)

Catalog No. ABIN630264

Product Details anti-CLDN10 Antibody

Target: CLDN10 (Claudin 10 (CLDN10))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLDN10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 10 antibody was raised against the C terminal of CLDN10

Purification: Purified

Immunogen: Claudin 10 antibody was raised using the C terminal of CLDN10 corresponding to a region with amino acids MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 10 Blocking Peptide, catalog no. 33R-5765, is also available for use as a blocking control in assays to test for specificity of this Claudin 10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLDN10

Target: CLDN10 (Claudin 10 (CLDN10))

Alternative Name: Claudin 10 (CLDN10 Products)

Synonyms: si:busm1-52i16.3 antibody, si:dz52i16.3 antibody, CLDN10 antibody, DKFZp469F1626 antibody, CPETRL3 antibody, OSP-L antibody, 6720456I16Rik antibody, Cldn10a antibody, Cldn10b antibody, D14Ertd728e antibody, claudin 10a antibody, claudin 10 antibody, cldn10a antibody, CLDN10 antibody, Cldn10 antibody

Background: CLDN10 encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Hepatitis C