Claudin 15 antibody (C-Term)

Catalog No. ABIN630261

Product Details anti-Claudin 15 Antibody

Target: Claudin 15 (CLDN15)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Claudin 15 antibody was raised against the C terminal of CLDN15

Purification: Purified

Immunogen: Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 15 Blocking Peptide, catalog no. 33R-4831, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 15

Target: Claudin 15 (CLDN15)

Alternative Name: Claudin 15 (CLDN15 Products)

Synonyms: CLDN15 antibody, cldn15 antibody, cldn15l antibody, zgc:63943 antibody, zgc:136755 antibody, 2210009B08Rik antibody, BB107105 antibody, claudin 15 antibody, claudin 15a antibody, claudin 15b antibody, Cldn15 antibody, CLDN15 antibody, cldn15a antibody, cldn15b antibody

Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C